PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC068128.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family YABBY
Protein Properties Length: 89aa    MW: 10210.5 Da    PI: 10.0544
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC068128.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY121.41.3e-37152119170
         YABBY 119 PekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                   PekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  EcC068128.10   1 PEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 52 
                   9*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF470951.01E-7146IPR009071High mobility group box domain
PfamPF046901.4E-35152IPR006780YABBY protein
Gene3DG3DSA:1.10.30.106.3E-5344IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
PEKRQRVPSA YNRFIKDEIQ RIKAGNPDIS HREAFSAAAK NWAHFPHIHF GLMPDHQPVK  60
KANLRQQEGE DVLMKDGFFT PTNVGVSPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056343.18e-62PREDICTED: axial regulator YABBY 1-like
SwissprotO221526e-51YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A059C5303e-57A0A059C530_EUCGR; Uncharacterized protein
TrEMBLA0A067E3D42e-57A0A067E3D4_CITSI; Uncharacterized protein
STRINGPOPTR_0014s06210.13e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22172877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.14e-52YABBY family protein